PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10010440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 712aa    MW: 76069.1 Da    PI: 8.7567
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10010440genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.76.1e-14206265362
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                  + k+  r+++NRe+A+ sRqRKk ++eeLe+kv ++ +  ++L  +++    e a+l+ +
  Lus10010440 206 DEKKKARLMRNRESAQLSRQRKKHYVEELEDKVRAMHSTITDLNGKISYFMAENASLRHQ 265
                  669999**************************************9999999999998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.0E-15204268IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.151206266IPR004827Basic-leucine zipper domain
PfamPF001702.8E-12207265IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.0E-12208266No hitNo description
Gene3DG3DSA:1.20.5.1701.0E-16208266No hitNo description
CDDcd147045.23E-21209260No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MADSAVDPVG FFTSDHDVGG GLASDLNSFN FDENFDIGID FDDLDSLYFP SETESFVLPD  60
SSPAGSPNND IAAAAAESGN SGVSGDVVGK YFNCDSDEGS TAMAAANRRV DSSPASSHGS  120
GNGRSTVSDT EAACCSPDSG SSEKKQKNVV KDEGEGNAKR KKEAGNGEQL RRQKCRVLEF  180
PSSVSKESDD SKAESGSVGQ QFGGEDEKKK ARLMRNRESA QLSRQRKKHY VEELEDKVRA  240
MHSTITDLNG KISYFMAENA SLRHQLGGGN GGMCPPPGMY PPPMTPMPYP WMPCAPYVVK  300
PQGSQVPLVP IPRLKPQHQQ PAMAKSKKGT GEGRKSETRT KKVASVSFLG LLFFVLMFGG  360
LVPLVNVKYG GVSDSNVAVN GWFSDQNFHG KVLVVDGHSN RTSGSINGGM HCEKGVKGRL  420
ECDKSREGGP ENVPKGSGFT STDNSTEQLH ASLYVPRNDK LVKIDGNLII HSVLASEKTK  480
RSHASATTES KPKETSLAVS KYLSAALAIP DGTTRRRLYR TTAEQQKAIG GRSRSADNLK  540
EQFKSSAADG KLQQWFHQGL AGPMLSSGVC SEVFQFDVSP SPGAIVTASS VTNLTNKPHN  600
ATTSAPPSDK KKHRRILHGL PVPLSTSDLN VTGDQHHRKG GQKNETSYNP AAASSSMVVS  660
VLVDPREVGD SDMVAPKKSL SRVFVVVLVD SVKYVTYSCV LPRSGPHLVR A*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8879928e-92HQ887992.1 Linum usitatissimum clone GMU2AYZ01ABWC6 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012462424.10.0PREDICTED: bZIP transcription factor 17
SwissprotO222081e-155BZP17_ARATH; bZIP transcription factor 17
TrEMBLA0A0D2V8N80.0A0A0D2V8N8_G
STRINGPOPTR_0016s03220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74873448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-124bZIP family protein